PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_B26A733D4.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 548aa    MW: 61373.1 Da    PI: 7.6748
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_B26A733D4.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.2e-171561148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g WT+eEde l +av+ + g++Wk++a+ ++  Rt+ qc +rwqk+l
  Traes_1DL_B26A733D4.1 15 KGGWTPEEDETLRKAVAVFKGKNWKRVAQFFP-DRTEVQCLHRWQKVL 61
                           688*****************************.************986 PP

2Myb_DNA-binding56.85.1e-1867113148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g+WT+eEde +++ vk++G+  W+ Iar +  gR +kqc++rw+++l
  Traes_1DL_B26A733D4.1  67 KGPWTQEEDETIIQKVKEHGPTKWSVIARSLH-GRIGKQCRERWHNHL 113
                            79******************************.*************97 PP

3Myb_DNA-binding59.86e-19119161145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            + +WT eE++ lvda++++G++ W+ Ia+ ++ gRt++++k++w+
  Traes_1DL_B26A733D4.1 119 KEAWTFEEEQVLVDAHRMHGNK-WAEIAKLLP-GRTDNSIKNHWN 161
                            579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6351061IPR017930Myb domain
SuperFamilySSF466898.61E-191375IPR009057Homeodomain-like
SMARTSM007171.4E-141463IPR001005SANT/Myb domain
PfamPF002491.7E-151561IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-231773IPR009057Homeodomain-like
CDDcd001671.66E-131861No hitNo description
PROSITE profilePS5129429.11462117IPR017930Myb domain
SuperFamilySSF466891.01E-3064160IPR009057Homeodomain-like
SMARTSM007173.6E-1666115IPR001005SANT/Myb domain
PfamPF002491.4E-1667113IPR001005SANT/Myb domain
CDDcd001672.12E-1469113No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2574116IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-23117168IPR009057Homeodomain-like
SMARTSM007171.2E-16118166IPR001005SANT/Myb domain
PROSITE profilePS5129422.338118168IPR017930Myb domain
PfamPF002499.8E-17119162IPR001005SANT/Myb domain
CDDcd001671.96E-13121161No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
SYSIRRISGP VRRAKGGWTP EEDETLRKAV AVFKGKNWKR VAQFFPDRTE VQCLHRWQKV  60
LDPELIKGPW TQEEDETIIQ KVKEHGPTKW SVIARSLHGR IGKQCRERWH NHLDPQIRKE  120
AWTFEEEQVL VDAHRMHGNK WAEIAKLLPG RTDNSIKNHW NSSVRKRLDE YDTGAAHPVP  180
VHVSHNDLKQ VAMALPSENY IDLNKEPNIS LRNHSVIVDH SVPTHSPRVC SLKNIMGCSD  240
FLSLSMPTAQ PVTSCQASVP DDSAVALTIM GMKMDSVRDK DMELNFVRQK GLQINLSNEK  300
GLEIDPVTAN PDGRESTLVK EAQSFGSLCY QIPKLEDIDL VRSPVLSRHH GSEHGVDGFQ  360
SPTGYATPSP TDGKQSDQLS VESILKSAAE NFPVTPSILR RRKRDKPTPS QDTDFKIDAN  420
SDGFDTPKAN CATYSPNSFK TASFLSLGRL DDQQLPSVLG KFDVSPTYRL RSKRMAVLKT  480
VEKHLDFSAD AMDTCDMVGT LKSSCRNTES VNASSDISSA HDRRINGHMI GLETLTSDFA  540
HTTQLDAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-67141685159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-67141685159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1399406RRRKRDKP
2400405RRKRDK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3635120.0AK363512.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2016D03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231305.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
RefseqXP_003568309.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
TrEMBLW5AHR40.0W5AHR4_WHEAT; Uncharacterized protein
STRINGMLOC_50701.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.29e-97myb domain protein 3r-5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]